PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC7680_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LFY
Protein Properties Length: 325aa    MW: 36418.8 Da    PI: 7.6025
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC7680_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY517.27e-158130189386
     FLO_LFY  89 lmkslseifrldllvGeryGikaavraerrrlee..eeaekkrrkll.....sedeetaldalsqeglseepvqeeke.aagsggeglgeaelvaaeek 179
                 +m+sls+ifr++llvGeryG+kaavraerrrl+e  ee+ ++rr+ll      + +++aldalsqeglse+pv++ ++ +a+ +++  g +e+ +a+  
  RrC7680_p3   1 MMNSLSHIFRWELLVGERYGVKAAVRAERRRLQEeeEEEYSRRRHLLlsaagDSGTHHALDALSQEGLSEDPVHQLEHtDAAGNNAVGGYWEAGQAK-- 97 
                 9*******************************99443445677777768744344556***************995551444444554556554443.. PP

     FLO_LFY 180 kseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedge...erqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGe 275
                      kk +  +++++k+  ++++++d+ +e e+d+d++g+g +g    erqrehPfivtepgevargkknGLDYLf+LyeqCrefL+qvq+iak+rGe
  RrC7680_p3  98 ----MKKPQ--QRRRKKQIVTSVETDDDMNEGEDDDDGNGNGGGGVlgiERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLVQVQTIAKDRGE 190
                 ....22222..23333443333333333333344444444333333445************************************************** PP

     FLO_LFY 276 kcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkL 374
                 kcPtkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvG+wrqacykplv+ia r+gwdidavfnahprLsiWYvPtkL
  RrC7680_p3 191 KCPTKVTNQVFRYAKKSGASYINKPKMRHYVHCYALHCLDEEASNALRRAFKERGENVGSWRQACYKPLVDIACRHGWDIDAVFNAHPRLSIWYVPTKL 289
                 *************************************************************************************************** PP

     FLO_LFY 375 rqLChlerskas 386
                 rqLChler++a+
  RrC7680_p3 290 RQLCHLERNNAV 301
                 ********9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.1E-1601300IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MMNSLSHIFR WELLVGERYG VKAAVRAERR RLQEEEEEEY SRRRHLLLSA AGDSGTHHAL  60
DALSQEGLSE DPVHQLEHTD AAGNNAVGGY WEAGQAKMKK PQQRRRKKQI VTSVETDDDM  120
NEGEDDDDGN GNGGGGVLGI ERQREHPFIV TEPGEVARGK KNGLDYLFHL YEQCREFLVQ  180
VQTIAKDRGE KCPTKVTNQV FRYAKKSGAS YINKPKMRHY VHCYALHCLD EEASNALRRA  240
FKERGENVGS WRQACYKPLV DIACRHGWDI DAVFNAHPRL SIWYVPTKLR QLCHLERNNA  300
VAAASALVGN GISCTGSSAS GGFGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy2_A1e-1271383211183PROTEIN LEAFY
2vy1_A1e-1271383211183PROTEIN LEAFY
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1100108PQQRRRKKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4492480.0AB449248.1 Raphanus sativus RsLFY1 mRNA for leafy-like protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013675387.10.0PREDICTED: protein LEAFY
RefseqXP_013727957.10.0PREDICTED: protein LEAFY
SwissprotQ009581e-178LFY_ARATH; Protein LEAFY
TrEMBLB7XD690.0B7XD69_RAPSA; Leafy-like protein
STRINGBra029305.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-162floral meristem identity control protein LEAFY (LFY)